>
产品中心 >
acid_base_buffer_solution >
StressMarq/Anti-SUR1 and SUR2B Antibody [S323A-31]/SMC-432D-A565/100-µg
Overview:
Product Name | SUR1 and SUR2B Antibody | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Description | Mouse Anti-Rat SUR1 and SUR2B Monoclonal IgG1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Species Reactivity | Mouse, Rat | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Applications | WB, ICC/IF | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Antibody Dilution | WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Host Species | Mouse | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Immunogen Species | Rat | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Immunogen | Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Concentration | 1 mg/ml | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Conjugates |
Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated
StreptavidinProperties:
Streptavidin Datasheet BiotinProperties:
Biotin Datasheet HRP (Horseradish peroxidase)Properties:
HRP Datasheet AP (Alkaline Phosphatase)Properties:
AP Datasheet
|
Properties
Storage Buffer | PBS pH7.4, 50% glycerol, 0.09% sodium azide |
Storage Temperature | -20ºC |
Shipping Temperature | Blue Ice or 4ºC |
Purification | Protein G Purified |
Clonality | Monoclonal |
Clone Number | S323A-31 |
Isotype | IgG1 |
Specificity | Detects ~175kDa and smaller fragments likely due to proteolytic cleavage. |
Cite This Product | StressMarq Biosciences Cat# SMC-432, RRID: AB_2701523 |
Certificate of Analysis | 1 µg/ml of SMC-432 was sufficient for detection of SUR1 and SUR2B in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody. |
Biological Description
Alternative Names | ABC36 Antibody, Abcc8 Antibody, ABCC8_HUMAN Antibody, ATP binding cassette sub family C (CFTR/MRP) member 8 Antibody, ATP binding cassette transporter sub family C member 8 (1) Antibody, ATP-binding cassette sub-family C member 8 Antibody, HHF1 Antibody, HI Antibody, HRINS Antibody, MRP8 Antibody, PHHI Antibody, Sulfonylurea receptor (hyperinsulinemia) Antibody, Sulfonylurea receptor 1 Antibody, SUR Antibody, SUR1 Antibody, SUR1delta2 Antibody, TNDM2 Antibody, ABC37 Antibody, abcC9 Antibody, ABCC9_HUMAN Antibody, AI414027 Antibody, AI449286 Antibody, ATFB12 Antibody, ATP-binding cassette sub-family C member 9 Antibody, ATP-binding cassette transporter sub-family C member 9 Antibody, ATP-binding cassette Antibody, sub-family C (CFTR/MRP) Antibody, member 9 Antibody, CANTU Antibody, CMD1O Antibody, FLJ36852 Antibody, Sulfonylurea receptor 2 Antibody, Sulfonylurea-binding protein 2 Antibody, SUR2 Antibody, SUR2A Antibody, SUR2B Antibody |
Research Areas | Cancer, Atherosclerosis, Cardiovascular System, Cell Markers, Cell Signaling, Cell Structure, Heart, Membrane Markers, Neuron Markers, Neuroscience |
Cellular Localization | Membrane |
Accession Number | NP_037172.2 |
Gene ID | 25560 |
Swiss Prot | Q63563 |
Scientific Background | Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2). |
References |
1. Campbell J.D., Sansom M.S., Ashcroft F.M. (2003) EMBO Resp. 4(11): 1038-1042. 2. Nichols C.G. (2006) Nature. 440 (7083): 470-476. |
Product Images
Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-SUR1 and SUR2B Monoclonal Antibody, Clone S323A-31 (SMC-432). Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-SUR1 and SUR2B Monoclonal Antibody (SMC-432) at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Membrane. Magnification: 60X. (A) DAPI (blue) nuclear stain (B) Phalloidin Texas Red F-Actin stain (C) SUR1 and SUR2B Antibody (D) Composite.
Western Blot analysis of Rat Brain Membrane showing detection of ~174 kDa SUR1/SUR2B protein using Mouse Anti-SUR1/SUR2B Monoclonal Antibody, Clone S323A-31 (SMC-432). Lane 1: MW Ladder. Lane 2: Rat Brain Membrane (10 µg). . Load: 10 µg. Block: 5% milk. Primary Antibody: Mouse Anti-SUR1/SUR2B Monoclonal Antibody (SMC-432) at 1:1000 for 1 hour at RT. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:200 for 1 hour at RT. Color Development: TMB solution for 10 min at RT. Predicted/Observed Size: ~174 kDa. Other Band(s): ~75 kDa.
Product Citations (0)
Currently there are no citations for this product.
ATTO 565 | ||
Overview:
ATTO 565 Datasheet | Optical Properties: λex = 563 nm λem = 592 nm εmax = 1.2×105 Φf = 0.9 τfl = 3.4 n Brightness = 10 Laser = 532 nm Filter set = TRITC |